PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G24630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 285aa    MW: 32783.4 Da    PI: 5.801
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G24630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-173178148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l++++  +G g+W++ ar  g++Rt+k+c++rw++yl
  ORUFI11G24630.1 31 RGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRTGKSCRLRWLNYL 78
                     89********************************************97 PP

2Myb_DNA-binding57.43.3e-1884127146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  ORUFI11G24630.1  84 RGNFTAEEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 127
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1942678IPR017930Myb domain
SuperFamilySSF466891.14E-3029125IPR009057Homeodomain-like
SMARTSM007171.0E-143080IPR001005SANT/Myb domain
PfamPF002491.2E-153178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-233285IPR009057Homeodomain-like
CDDcd001675.88E-103378No hitNo description
PROSITE profilePS5129424.45179133IPR017930Myb domain
SMARTSM007173.3E-1683131IPR001005SANT/Myb domain
PfamPF002491.3E-1684127IPR001005SANT/Myb domain
CDDcd001673.29E-1186127No hitNo description
Gene3DG3DSA:1.10.10.606.5E-2586132IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEMVLQRTSH HPVPGEQQEA AAELSSAELR RGPWTVDEDL TLINYISDHG EGRWNALARA  60
AGLKRTGKSC RLRWLNYLRP DVKRGNFTAE EQLLILDLHS RWGNRWSKIA QHLPGRTDNE  120
IKNYWRTRVQ KHAKQLNCDV NSKRFKDAMK YLWMPRLAER IHARAGAVDD SGDYSNNDLS  180
CVSGVTMATV ANCFDGSPSM VTSSSSDSFT SESQDLKKIN LHVHGDDEKM NSEDWMQEVD  240
HEFWSTEIQP NNEQFQDQQL NGWVQGFSEG LSETLWSLED IWKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262313119126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0263320.0AY026332.1 Oryza sativa Myb transcription factor JAMyb mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618000.10.0PREDICTED: transcription factor MYB108
TrEMBLA0A0E0RC240.0A0A0E0RC24_ORYRU; Uncharacterized protein
TrEMBLQ2QZJ80.0Q2QZJ8_ORYSJ; Expressed protein
TrEMBLQ9ARI80.0Q9ARI8_ORYSA; Myb transcription factor JAMyb
STRINGLOC_Os11g45740.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-80myb domain protein 112